| Primary information |
|---|
| ID | 11030 |
| Uniprot ID | P69068 |
| Description | Calcitonin-2. |
| Organism | Oncorhynchus nerka |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Length | 32 |
| Molecular Weight | 3387 |
| Name | Calcitonin-2 |
| Sequence | CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP |
| Sequence map | 32 (1-32) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|