| Primary information |
|---|
| ID | 11028 |
| Uniprot ID | P01263 |
| Description | Calcitonin-1 precursor. |
| Organism | Oncorhynchus keta |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Length | 136 |
| Molecular Weight | 15179 |
| Name | Calcitonin-1 |
| Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| Sequence map | 32 (83-114) |
| PDB ID | 2GLG2GLH |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | Available under the names Calcimar (Rhone-Poulenc Rorer); Miacalcin (Novartis) or Forcaltonin (Unigene). Used for the treatment of Paget's disease and hypercalcemia in malignancy.
|