| Primary information |
|---|
| ID | 11001 |
| Uniprot ID | P09319 |
| Description | Prolactin-1 precursor (Prolactin I) (PRL-188). |
| Organism | Oreochromis mossambicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 212 |
| Molecular Weight | 23530 |
| Name | Prolactin-1 |
| Sequence | VPINELFERASQHSDKLHSLSTTLTQELDSHFPPIGRVIMPRPAMCHTSSLQTPIDKDQALQVSESDLMSLARSLLQAWSDPLVVLSSSASTLPHPAQSTIFNKIQEMQQYSKSLKDGLDVLSSKMGSPAQAITSLPYRGGTNLGHDKITKLINFNFLLSCLRRDSHKIDSFLKVLRCRAAKMQPEMC |
| Sequence map | 188 (25-212) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|