| Primary information |
|---|
| ID | 10997 |
| Uniprot ID | P55751 |
| Description | Prolactin-1 (Prolactin I) (PRL-I). |
| Organism | Alligator mississippiensis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Glycosylated. |
| Function | NA |
| Length | 199 |
| Molecular Weight | 22756 |
| Name | Prolactin-1 |
| Sequence | LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHNASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC |
| Sequence map | 199 (1-199) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|