| Primary information |
|---|
| ID | 10933 |
| Uniprot ID | P21252 |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); B |
| Organism | Loxodonta africana |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Beta-endorphin is an endogenous opiate |
| Length | 134 |
| Molecular Weight | 14935 |
| Name | Beta-endorphin |
| Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH |
| Sequence map | 31 (104-134) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|