Primary information |
---|
ID | 10928 |
Uniprot ID | P21252 |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); B |
Organism | Loxodonta africana |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta. |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Length | 134 |
Molecular Weight | 14935 |
Name | Corticotropin |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEF |
Sequence map | 39 (1-39) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|