| Primary information |
|---|
| ID | 10901 |
| Uniprot ID | P12705 |
| Description | Insulin precursor [Cleaved into- - Insulin B chain; Insulin A chain](Fragments). |
| Organism | Torpedo marmorata |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Torpediniformes; Torpedinoidei; Torpedinidae; Torpedo. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver |
| Length | 70 |
| Molecular Weight | 7663 |
| Name | Insulin B chain |
| Sequence | LPSQHLCGSHLVEALYFVCGPKGFYYLPKA |
| Sequence map | 30 (1-30) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|