| Primary information |
|---|
| ID | 10859 |
| Uniprot ID | P01330 |
| Description | Insulin [Cleaved into- - Insulin B chain; Insulin A chain]. |
| Organism | Myocastor coypus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Myocastoridae; Myocastor. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver |
| Length | 51 |
| Molecular Weight | 5897 |
| Name | Insulin B chain |
| Sequence | YVSQRLCGSQLVDTLYSVCRHRGFYRPNDG |
| Sequence map | 29 (1-29) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|