Primary information |
---|
ID | 10781 |
Uniprot ID | O73824 |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Organism | Salmo salar |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Length | 139 |
Molecular Weight | 15449 |
Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYHTLA |
Sequence map | 119 (21-139) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|