| Primary information |
|---|
| ID | 10780 |
| Uniprot ID | P37240 |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Organism | Oncorhynchus mykiss |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | Pituitary gland. Higher levels seen in immature fishes than the mature fishes |
| Post Translational Modification | NA |
| Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
| Length | 147 |
| Molecular Weight | 16440 |
| Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNSYIHPN |
| Sequence map | 127 (21-147) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|