| Primary information |
|---|
| ID | 10779 |
| Uniprot ID | Q95J88 |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Organism | Monodelphis domestica |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Indispensable for the control of thyroid structure and metabolism |
| Length | 138 |
| Molecular Weight | 15398 |
| Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Sequence | LCVPTGYTMHIERRECAYCLTINTTICAGYCMTRDSNGKLFLPKSALSQDVCTYRDVIYRTVVMPGCPPHVIPYISYPVAVSCRCGKCNTDYIDCIHESVTTNYCTKPQKPY |
| Sequence map | 112 (21-132) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|