Primary information |
---|
ID | 10768 |
Uniprot ID | O70615 |
Description | Somatotropin precursor (Growth hormone). |
Organism | Spalax leucodon ehrenbergi |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Spalacidae; Spalacinae; Nannospalax. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Length | 216 |
Molecular Weight | 24627 |
Name | Somatotropin |
Sequence | FPAMPLSNLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRSDMELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVFEKLKDLEEGIQALMRELEDGSLRAGQLLKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
Sequence map | 190 (27-216) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|