| Primary information |
|---|
| ID | 10719 |
| Uniprot ID | P11228 |
| Description | Somatotropin precursor (Growth hormone). |
| Organism | Anas platyrhynchos |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Anseriformes; Anatidae; Anas. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Growth hormone plays an important role in growth control |
| Length | 216 |
| Molecular Weight | 24896 |
| Name | Somatotropin |
| Sequence | ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERSYIPEDQRHTNKNSQAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLKPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI |
| Sequence map | 191 (26-216) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|