| Primary information |
|---|
| ID | 10712 |
| Uniprot ID | O93359 |
| Description | Somatotropin-1 precursor (Somatotropin I) (Growth hormone I). |
| Organism | Carassius auratus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Length | 210 |
| Molecular Weight | 23759 |
| Name | Somatotropin-1 (Somatotropin I) (Growth hormone I) |
| Sequence | SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPTGKDETQKSSMLKLLRVSFRLIESWEFPSQTLSGTVSNSLTVGNPNQITEKLADLKMGISVLIQACLDGQPNMDDNDSLPLPFEEFYLTMGDNSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Sequence map | 188 (23-210) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|