Primary information |
---|
ID | 10711 |
Uniprot ID | P26773 |
Description | Somatotropin-1 (Somatotropin I) (Growth hormone I). |
Organism | Acipenser guldenstadti |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Length | 190 |
Molecular Weight | 21791 |
Name | Somatotropin-1 (Somatotropin I) (Growth hormone I) |
Sequence | YPMIPLSSLFTNAVLRAQYLHQLAADIYKDFERTYMPNEQRHSSKNSPSAFCYSETIPAPTGKDEAQQRSDVELLQFSLALIQSWISPLQSLSRVFTNSLVFLTSDRVFEKLKDLEEGIVALMRDLGEGGFGSSTLLKLTYDKFDVNLRNDDALFKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTL |
Sequence map | 190 (1-190) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|