| Primary information |
|---|
| ID | 10707 |
| Uniprot ID | P42692 |
| Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
| Organism | Cyprinus carpio |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Length | 45 |
| Molecular Weight | 4979 |
| Name | Somatoliberin |
| Sequence | HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS |
| Sequence map | 45 (1-45) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|