| Primary information |
|---|
| ID | 10681 |
| Uniprot ID | P01298 |
| Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Cleaved into- - Pancreatic hormone; Pancreatic icosapeptide]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Length | 95 |
| Molecular Weight | 10445 |
| Name | Pancreatic hormone |
| Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |
| Sequence map | 36 (30-65) |
| PDB ID | 1TZ41TZ5 |
| Drugpedia | NA |
| Receptor | P25929; P50391 |
| Domain | NA |
| Pharmaceutical Use | Obinepitide is under clinical trial by 7TM Pharma to be used for the treatment of obesity. Obinepitide is derived from pancreatic hormone by having Gln-63.
|