Primary information |
---|
ID | 10681 |
Uniprot ID | P01298 |
Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Cleaved into- - Pancreatic hormone; Pancreatic icosapeptide]. |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the NPY family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Length | 95 |
Molecular Weight | 10445 |
Name | Pancreatic hormone |
Sequence | APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY |
Sequence map | 36 (30-65) |
PDB ID | 1TZ41TZ5 |
Drugpedia | NA |
Receptor | P25929; P50391 |
Domain | NA |
Pharmaceutical Use | Obinepitide is under clinical trial by 7TM Pharma to be used for the treatment of obesity. Obinepitide is derived from pancreatic hormone by having Gln-63.
|