| Primary information |
|---|
| ID | 10675 |
| Uniprot ID | P68248 |
| Description | Pancreatic hormone precursor (Pancreatic polypeptide) (PP). |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Length | 80 |
| Molecular Weight | 8773 |
| Name | Pancreatic hormone |
| Sequence | GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY |
| Sequence map | 36 (26-61) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|