| Primary information |
|---|
| ID | 10672 |
| Uniprot ID | P13083 |
| Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Cleaved into- - Pancreatic hormone; Pancreatic icosapeptide-like]. |
| Organism | Cavia porcellus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Length | 126 |
| Molecular Weight | 13489 |
| Name | Pancreatic hormone |
| Sequence | APLEPVYPGDDATPQQMAQYAAEMRRYINMLTRPRY |
| Sequence map | 36 (27-62) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|