Primary information |
---|
ID | 10665 |
Uniprot ID | Q09169 |
Description | Glucagon family neuropeptides precursor [Cleaved into- - Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)]. |
Organism | Rana ridibunda |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator. Stimulates adenylate cyclase in pituitary cells |
Length | 171 |
Molecular Weight | 19680 |
Name | Pituitary adenylate cyclase-activating polypeptide 38 |
Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK |
Sequence map | 38 (127-164) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|