| Primary information |
|---|
| ID | 10665 |
| Uniprot ID | Q09169 |
| Description | Glucagon family neuropeptides precursor [Cleaved into- - Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)]. |
| Organism | Rana ridibunda |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator. Stimulates adenylate cyclase in pituitary cells |
| Length | 171 |
| Molecular Weight | 19680 |
| Name | Pituitary adenylate cyclase-activating polypeptide 38 |
| Sequence | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK |
| Sequence map | 38 (127-164) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|