Primary information |
---|
ID | 10660 |
Uniprot ID | P48144 |
Description | Glucagon family neuropeptides precursor [Cleaved into- - Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
Organism | Clarias macrocephalus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Brain; testis; ovary and stomach. Not pancreas; pituitary; muscle and liver |
Post Translational Modification | NA |
Function | Primary role of GHRH is to release GH from the pituitary |
Length | 195 |
Molecular Weight | 22443 |
Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
Sequence | HADGLLDRALRDILVQLSARKYLHSLTAVRVGEEEEDEEDSEPLS |
Sequence map | 45 (83-127) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|