| Primary information |
|---|
| ID | 10660 |
| Uniprot ID | P48144 |
| Description | Glucagon family neuropeptides precursor [Cleaved into- - Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide (PACAP)]. |
| Organism | Clarias macrocephalus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Brain; testis; ovary and stomach. Not pancreas; pituitary; muscle and liver |
| Post Translational Modification | NA |
| Function | Primary role of GHRH is to release GH from the pituitary |
| Length | 195 |
| Molecular Weight | 22443 |
| Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
| Sequence | HADGLLDRALRDILVQLSARKYLHSLTAVRVGEEEEDEEDSEPLS |
| Sequence map | 45 (83-127) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|