Primary information |
---|
ID | 10653 |
Uniprot ID | P56688 |
Description | Mandibular organ-inhibiting hormone precursor (MOIH) [Cleaved into- - MOIHprecursor-related peptide; Mandibular organ-inhibiting hormone]. |
Organism | Libinia emarginata |
Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Majoidea; Majidae; Libinia. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
Post Translational Modification | NA |
Function | Represses the synthesis of methyl farnesoate; the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity |
Length | 137 |
Molecular Weight | 15370 |
Name | Mandibular organ-inhibiting hormone |
Sequence | QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV |
Sequence map | 72 (63-134) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|