| Primary information |
|---|
| ID | 10653 |
| Uniprot ID | P56688 |
| Description | Mandibular organ-inhibiting hormone precursor (MOIH) [Cleaved into- - MOIHprecursor-related peptide; Mandibular organ-inhibiting hormone]. |
| Organism | Libinia emarginata |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Brachyura;Eubrachyura; Majoidea; Majidae; Libinia. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
| Post Translational Modification | NA |
| Function | Represses the synthesis of methyl farnesoate; the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity |
| Length | 137 |
| Molecular Weight | 15370 |
| Name | Mandibular organ-inhibiting hormone |
| Sequence | QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV |
| Sequence map | 72 (63-134) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|