| Primary information |
|---|
| ID | 10650 |
| Uniprot ID | P55847 |
| Description | Molt-inhibiting hormone precursor (MIH) (PeJ-SGP-IV). |
| Organism | Penaeus japonicus |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Marsupenaeus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released |
| Post Translational Modification | NA |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted A molting cycle is initiated when MIH secretion diminishes or stops. Has little or no hyperglycemic activity |
| Length | 105 |
| Molecular Weight | 12150 |
| Name | Molt-inhibiting hormone |
| Sequence | SFIDNTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRNRCFYNEWFLICLKAANREDEIEKFRVWISILNAGQ |
| Sequence map | 77 (29-105) |
| PDB ID | 1J0T |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|