| Primary information |
|---|
| ID | 10649 |
| Uniprot ID | O76534 |
| Description | Probable molt-inhibiting hormone precursor (MEE-MIH). |
| Organism | Metapenaeus ensis |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Metapenaeus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Expressed in the postmolt; intermolt; and premolt stages of the shrimp eyestalks and the brain |
| Post Translational Modification | NA |
| Function | Inhibits Y-organs where molting hormone (ecdysteroid) is secreted A molting cycle is initiated when MIH secretion diminishes or stops |
| Length | 105 |
| Molecular Weight | 12117 |
| Name | Probable molt-inhibiting hormone |
| Sequence | SYIENTCRGVMGNRDIYKKVVRVCEDCTNIFRLPGLDGMCRDRCFNNEWFLVCLKAANRDDELDKFKVWISILNPGL |
| Sequence map | 77 (29-105) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|