| Primary information |
|---|
| ID | 10645 |
| Uniprot ID | P01230 |
| Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Length | 141 |
| Molecular Weight | 15177 |
| Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Sequence | SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF |
| Sequence map | 121 (21-141) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|