| Primary information |
|---|
| ID | 10642 |
| Uniprot ID | P25330 |
| Description | Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain). |
| Organism | Physeter catodon |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Odontoceti; Physeteridae; Physeter. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Length | 118 |
| Molecular Weight | 12412 |
| Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Sequence | PRGPLRPLCRPINATLAAQNZACPVCITFTTSICAGYCPSMVRVLPAALPPVPZPVCTYRQLRFASIRLPGCPPGVNPMVSFPVALSCHCGPCRLSSSDCGPGRAQPLACNRSPRPGL |
| Sequence map | 118 (1-118) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|