| Primary information |
|---|
| ID | 10639 |
| Uniprot ID | P08751 |
| Description | Lutropin/choriogonadotropin subunit beta precursor (LSH-B/CG-B)(Luteinizing hormone subunit beta) (Lutropin/choriogonadotropin betachain). |
| Organism | Equus caballus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | Microheterogeneity at Asn-33. O-glycosylation appears to be responsible for the beta subunit contribution to the difference in LH-receptor binding activity between LSH-B and CG-B. |
| Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
| Length | 169 |
| Molecular Weight | 17865 |
| Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
| Sequence | SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPAIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFRDQPLACAPQASSSSKDPPSQPLTSTSTPTPGASRRSSHPLPIKTS |
| Sequence map | 149 (21-169) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|