Primary information |
---|
ID | 10635 |
Uniprot ID | P45657 |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Organism | Coturnix coturnix japonica |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Coturnix. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Length | 166 |
Molecular Weight | 17030 |
Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Sequence | TPPLVVDPSIGSQLGLGSVLGLDLGSMGGSGRPPCRPINVTVAVEKEECPQCMAVTTTACGGYCRTREPVYRSPLGPPPQSSCTYGALRYERWDLWGCPIGSDPKVILPVALSCRCARCPIATSDCTVQGLGPAFCGAPGGFGGQ |
Sequence map | 145 (22-166) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|