| Primary information |
|---|
| ID | 10619 |
| Uniprot ID | P30970 |
| Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
| Organism | Acanthopagrus latus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Acanthopagrus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis |
| Length | 117 |
| Molecular Weight | 13061 |
| Name | Glycoprotein hormones alpha chain |
| Sequence | YPNTDLSNMGCEACTLRKNTVFSRDRPIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAGIRVRNHTDCHCSTCYYHKI |
| Sequence map | 94 (24-117) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|