| Primary information |
|---|
| ID | 10616 |
| Uniprot ID | P13152 |
| Description | Glycoprotein hormones alpha chain 1 precursor (Gonadotropin 1 alphachain) (GTH-alpha) (Fragment). |
| Organism | Oncorhynchus keta |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis |
| Length | 108 |
| Molecular Weight | 12047 |
| Name | Glycoprotein hormones alpha chain 1 |
| Sequence | YQNSDMTNVGCEECKLKENKVFSNPGAPVYQCTGCCFSRAYPTPLQSKKAMLVPKNITSEATCCVAKEGERVVVDNIKLTNHTECWCNTCYHHKS |
| Sequence map | 95 (14-108) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|