| Primary information |
|---|
| ID | 10612 |
| Uniprot ID | P17685 |
| Description | ELH type 1 precursor [Cleaved into- - Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide]. |
| Organism | Aplysia parvula |
| Txonomy | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the molluscan ELH family. |
| Tissue Specificity | Bag cell neurons |
| Post Translational Modification | NA |
| Function | ELH acts as a neurotransmitter locally; upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
| Length | 263 |
| Molecular Weight | 29676 |
| Name | Egg-laying hormone |
| Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
| Sequence map | 36 (198-233) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|