Primary information |
---|
ID | 10612 |
Uniprot ID | P17685 |
Description | ELH type 1 precursor [Cleaved into- - Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide]. |
Organism | Aplysia parvula |
Txonomy | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | Bag cell neurons |
Post Translational Modification | NA |
Function | ELH acts as a neurotransmitter locally; upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
Length | 263 |
Molecular Weight | 29676 |
Name | Egg-laying hormone |
Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
Sequence map | 36 (198-233) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|