| Primary information |
|---|
| ID | 10605 |
| Uniprot ID | P01362 |
| Description | ELH precursor [Cleaved into- - Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide]. |
| Organism | Aplysia californica |
| Txonomy | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the molluscan ELH family. |
| Tissue Specificity | Bag cell neurons |
| Post Translational Modification | NA |
| Function | NA |
| Length | 271 |
| Molecular Weight | 30827 |
| Name | Gamma-delta-bag cell peptide |
| Sequence | RLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
| Sequence map | 46 (103-148) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|