| Primary information |
|---|
| ID | 10603 |
| Uniprot ID | Q07892 |
| Description | Eclosion hormone precursor (Ecdysis activator) (EH). |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect eclosion hormone family. |
| Tissue Specificity | Expressed in a single pair of brain neurons which extend their processes the entire length of the central nervous system and also to the corpora cardiaca portion of the ring gland. These cells show ma |
| Post Translational Modification | NA |
| Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns- larval; pupal and adult ecdysis; and plasticization during the molt |
| Length | 97 |
| Molecular Weight | 10610 |
| Name | Eclosion hormone |
| Sequence | LVHFGNALPAISHYTHKRFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE |
| Sequence map | 80 (18-97) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|