| Primary information |
|---|
| ID | 10602 |
| Uniprot ID | P25331 |
| Description | Eclosion hormone precursor (Ecdysis activator) (EH). |
| Organism | Bombyx mori |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect eclosion hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns- larval; pupal and adult ecdysis; and plasticization during the molt |
| Length | 88 |
| Molecular Weight | 9505 |
| Name | Eclosion hormone |
| Sequence | SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL |
| Sequence map | 62 (27-88) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|