| Primary information |
|---|
| ID | 10601 |
| Uniprot ID | P67801 |
| Description | Diuretic hormone (DH) (Diuretic peptide) (DP). |
| Organism | Stomoxys calcitrans |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea;Muscidae; Stomoxys. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. May act as clearance peptide in that it may remove metabolic waste from the hemolymph |
| Length | 44 |
| Molecular Weight | 5181 |
| Name | Diuretic hormone |
| Sequence | NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV |
| Sequence map | 44 (1-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|