| Primary information |
|---|
| ID | 10598 |
| Uniprot ID | P23465 |
| Description | Diuretic hormone (DH) (Diuretic peptide) (DP). |
| Organism | Locusta migratoria |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Orthopteroidea; Orthoptera; Caelifera; Acridomorpha;Acridoidea; Acrididae; Oedipodinae; Locusta. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules |
| Length | 46 |
| Molecular Weight | 5364 |
| Name | Diuretic hormone |
| Sequence | MGMGPSLSIVNPMDVLRQRLLLEIARRRLRDAEEQIKANKDFLQQI |
| Sequence map | 46 (1-46) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|