| Primary information |
|---|
| ID | 10594 |
| Uniprot ID | P34207 |
| Description | Chorionic somatomammotropin hormone 1 variant precursor (Placentallactogen I variant) (PL-IV). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | Predominantly synthesized during the later stage of gestation. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | N-glycosylated. |
| Function | NA |
| Length | 223 |
| Molecular Weight | 25844 |
| Name | Prolactin-3D4 |
| Sequence | SKPTVLVSTEDLYHRLVEQSHNTFIKAADVYREFDINFAKRSWMKDRILPLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHFVSAVTDLPGASASMRKKAVDMKDKNLIILEGLQKIFNRTQTKVEENENFDYPAWSGLKDLQSSDEDTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKNEC |
| Sequence map | 195 (29-223) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|