| Primary information |
|---|
| ID | 10593 |
| Uniprot ID | P19159 |
| Description | Chorionic somatomammotropin hormone 2 precursor (Placental lactogenII) (BPLP-II). |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 238 |
| Molecular Weight | 27714 |
| Name | Chorionic somatomammotropin hormone 2 |
| Sequence | ISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC |
| Sequence map | 202 (37-238) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|