| Primary information |
|---|
| ID | 10590 |
| Uniprot ID | P49926 |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Organism | Canis familiaris |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Length | 196 |
| Molecular Weight | 21547 |
| Name | Corticoliberin |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Sequence map | 41 (154-194) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|