| Primary information |
|---|
| ID | 10589 |
| Uniprot ID | P25308 |
| Description | Corticoliberin-2 precursor (Corticotropin-releasing factor 2) (CRF 2)(Corticotropin-releasing hormone 2). |
| Organism | Catostomus commersoni |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Catostomidae; Catostomus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Length | 162 |
| Molecular Weight | 18605 |
| Name | Corticoliberin-2 |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLVQQAHSNRKMMEIF |
| Sequence map | 41 (120-160) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|