| Primary information |
|---|
| ID | 10588 |
| Uniprot ID | P68000 |
| Description | Corticotropin-lipotropin (Pro-opiomelanocortin) (POMC) [Cleaved into- -Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP)](Fragment). |
| Organism | Balaenoptera borealis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post Translational Modification | NA |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Length | 39 |
| Molecular Weight | 4541 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Sequence map | 39 (1-39) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|