| Primary information |
|---|
| ID | 10587 |
| Uniprot ID | P55845 |
| Description | Crustacean hyperglycemic hormone (CHH). |
| Organism | Procambarus bouvieri |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Astacoidea; Cambaridae; Procambarus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post Translational Modification | Stereoinversion of L-Phe (in CHH-I) to D-Phe (in CHH-II) the two forms are present in a ratio 3-1 (CHH-I/CHH-II). |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 72 |
| Molecular Weight | 8411 |
| Name | Crustacean hyperglycemic hormone |
| Sequence | QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV |
| Sequence map | 72 (1-72) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|