| Primary information |
|---|
| ID | 10585 |
| Uniprot ID | O77220 |
| Description | Crustacean hyperglycemic hormones precursor [Cleaved into- - CHH precursor-related peptide (CPRP); Crustacean hyperglycemic hormone (CHH)]. |
| Organism | Macrobrachium lanchesteri |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Caridea;Palaemonoidea; Palaemonidae; Macrobrachium. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released |
| Post Translational Modification | NA |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 135 |
| Molecular Weight | 15198 |
| Name | Crustacean hyperglycemic hormone |
| Sequence | AILDQSCKGIFDRELFKKLDRVCDDCYNLYRKPYVAIDCREGCYQNLVFRQCIQDLQLMDQLDEYANAVQIV |
| Sequence map | 72 (62-133) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|