Primary information |
---|
ID | 10584 |
Uniprot ID | P59685 |
Description | Crustacean hyperglycemic hormone (CHH). |
Organism | Litopenaeus schmitti |
Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Litopenaeus. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
Length | 72 |
Molecular Weight | 8366 |
Name | Crustacean hyperglycemic hormone |
Sequence | ANFDPSCTGVYDRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
Sequence map | 72 (1-72) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|