| Primary information |
|---|
| ID | 10574 |
| Uniprot ID | O97385 |
| Description | Crustacean hyperglycemic hormones 3 precursor (Pm-SGP-III) [Cleaved into- -CHH precursor-related peptide 3 (CPRP 3); Crustacean hyperglycemichormone 3 (CHH 3)]. |
| Organism | Penaeus monodon |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Penaeus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 102 |
| Molecular Weight | 11621 |
| Name | Crustacean hyperglycemic hormone 3 |
| Sequence | ANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRNNCFYNPVFVQCLEYLIPADLHEEYQAHVQTV |
| Sequence map | 72 (29-100) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|