Primary information |
---|
ID | 10518 |
Uniprot ID | Q9VLK4 |
Description | Diuretic hormone class-II precursor (Diuretic peptide) (DP) (DH(31)). |
Organism | Drosophila melanogaster |
Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the diuretic hormone class II family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Regulation of fluid secretion. Stimulates Malpighian tubules fluid secretion by activating the apical membrane V-ATPase via cyclic AMP of principal cells in the main secretory segment |
Length | 116 |
Molecular Weight | 12622 |
Name | Diuretic hormone class-II |
Sequence | TVDFGLARGYSGTQEAKHRMGLAAANFAGGP |
Sequence map | 31 (76-106) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|