| Primary information |
|---|
| ID | 10517 |
| Uniprot ID | Q9NGP0 |
| Description | Crustacean hyperglycemic hormones B precursor (CHH-B) (MeCHH-B)[Cleaved into- - CHH precursor-related peptide B (CPRP B); Crustaceanhyperglycemic hormone B (CHH B)]. |
| Organism | Metapenaeus ensis |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Dendrobranchiata; Penaeoidea;Penaeidae; Metapenaeus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Expressed at a constant level in the eyestalks of juveniles and mature females. A low level expression is seen in the central nervous system |
| Post Translational Modification | NA |
| Function | Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction |
| Length | 113 |
| Molecular Weight | 12937 |
| Name | Crustacean hyperglycemic hormone B |
| Sequence | SLFDPSCTGVFDRELLGRLNRVCDDCYNVFREPKVATECRSHCFLNPAFIQCLEYIIPEVLHEEYQANVQLV |
| Sequence map | 72 (40-111) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|