| Primary information |
|---|
| ID | 10512 |
| Uniprot ID | Q86SA8 |
| Description | Androgenic gland hormone precursor (Pod-AGH) [Cleaved into- - Androgenicgland hormone B chain; Androgenic gland hormone A chain]. |
| Organism | Porcellio dilatatus |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Peracarida; Isopoda; Oniscidea; Porcellionidae;Porcellio. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Androgenic gland |
| Post Translational Modification | NA |
| Function | Controls sex differentiation and the formation of male appendages; spermatogenesis; pigmentation; and male specific behavior |
| Length | 146 |
| Molecular Weight | 17425 |
| Name | Androgenic gland hormone A chain |
| Sequence | DIAFHEECCNIRTEHKCNRTTVELYCRRYSP |
| Sequence map | 31 (116-146) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|