| Primary information |
|---|
| ID | 10445 |
| Uniprot ID | P19209 |
| Description | Somatostatin precursor [Cleaved into- - Somatostatin-34; Somatostatin-14](Fragment). |
| Organism | Myxine glutinosa |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatostatin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Somatostatin inhibits the release of somatotropin |
| Length | 34 |
| Molecular Weight | 3963 |
| Name | Somatostatin-34 |
| Sequence | AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC |
| Sequence map | 34 (1-34) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|