| Primary information |
|---|
| ID | 10442 |
| Uniprot ID | P17219 |
| Description | Prothoracicotropic hormone precursor (PTTH) [Cleaved into- - P2K; P6K;Prothoracicotropic hormone]. |
| Organism | Bombyx mori |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain |
| Post Translational Modification | NA |
| Function | PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone; the steroid essential to insect development |
| Length | 224 |
| Molecular Weight | 26028 |
| Name | Prothoracicotropic hormone |
| Sequence | GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN |
| Sequence map | 109 (116-224) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|